Novus Biologicals
Manufacturer Code:NBP233629
Catalog # NBP233629
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DLDAEEENIQEGPKETIEIETQVPEKKKGIFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: D22S675 High affinity sodium-glucose cotransporter Na+/glucose cotransporter 1 NAGTsodium/glucose cotransporter 1 SGLT1Na(+)/glucose cotransporter 1 solute carrier family 5 (sodium/glucose cotransporter) member 1 Solute carrier family 5 member 1; High affinity sodium-glucose cotransporter; Na(+)/glucose cotransporter 1; Na+/glucose cotransporter 1; Sodium/glucose cotransporter 1; solute carrier family 5 (sodium/glucose cotransporter), member 1; Solute carrier family 5 member 1
Gene Aliases: D22S675; NAGT; SGLT1; SLC5A1
UniProt ID: (Human) P13866
Entrez Gene ID: (Human) 6523
Molecular Function: carbohydrate transporter cation transporter transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.