Novus Biologicals
Manufacturer Code:NBP238200
Catalog # NBP238200
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LGWDGKPIPYWLYKLHGLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: pre-mRNA splicing factor SF3a (60kD); PRP9 PRPF9 SAP 61 SAP61splicing factor 3a subunit 3 60kD SF3a60pre-mRNA splicing factor SF3a (60kD) spliceosome associated protein 61 Spliceosome-associated protein 61 splicing factor 3A subunit 3 splicing factor 3a subunit 3 60kDa; SAP 61; SF3a60; spliceosome associated protein 61; Spliceosome-associated protein 61; Splicing factor 3A subunit 3; splicing factor 3a, subunit 3, 60kD; splicing factor 3a, subunit 3, 60kDa
Gene Aliases: PRP9; PRPF9; SAP61; SF3A3; SF3a60
UniProt ID: (Human) Q12874
Entrez Gene ID: (Human) 10946
Molecular Function: RNA binding protein mRNA processing factor mRNA splicing factor nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.