Novus Biologicals
Manufacturer Code:NBP15282320UL
Catalog # NBP15282320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SF1/Steroidogenic Factor 1 The peptide sequence was selected from the middle region of SF1/Steroidogenic Factor 1. Peptide sequence SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AD4BPSTF-1 Adrenal 4-binding protein ELP FTZ1adrenal 4 binding protein FTZF1nuclear receptor AdBP4 Fushi tarazu factor homolog 1 Nuclear receptor subfamily 5 group A member 1 nuclear receptor subfamily 5 group A member 1 SF-1POF7 SF1steroidogenic factor 1 Steroid hormone receptor Ad4BP steroidogenic factor-1; adrenal 4 binding protein; Adrenal 4-binding protein; Fushi tarazu factor homolog 1; nuclear receptor AdBP4; Nuclear receptor subfamily 5 group A member 1; nuclear receptor subfamily 5, group A, member 1; SF-1; Steroid hormone receptor Ad4BP; Steroidogenic factor 1; steroidogenic factor 1 nuclear receptor; steroidogenic factor-1; STF-1
Gene Aliases: AD4BP; ELP; FTZ1; FTZF1; hSF-1; NR5A1; POF7; SF-1; SF1; SPGF8; SRXY3
UniProt ID: (Human) Q13285
Entrez Gene ID: (Human) 2516
Molecular Function:
nuclear hormone receptor
nucleic acid binding
receptor
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.