Novus Biologicals
Manufacturer Code:NBP258313
Catalog # NBP258313
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ELSYDYSGRYLNLTVSEDKERLDHGKLRKPCYCGAKSCTAFLPFDSSLYCPVEKSNISCGNEKEPSMCGSAPSVFPSCKRLTL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.1.1.43 histone-lysine N-methyltransferase SETMAR hsMar1 metnase SET domain and mariner transposase fusion gene SET domain and mariner transposase fusion gene-containing protein; Histone-lysine N-methyltransferase; Histone-lysine N-methyltransferase SETMAR; Metnase; SET domain and mariner transposase fusion gene-containing protein; SET domain and mariner transposase fusion protein; Transposon Hsmar1 transposase
Gene Aliases: Mar1; METNASE; SETMAR
UniProt ID: (Human) Q53H47
Entrez Gene ID: (Human) 6419
Molecular Function: DNA binding protein methyltransferase nucleic acid binding transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.