Novus Biologicals
Manufacturer Code:NBP234101
Catalog # NBP234101
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFTPNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.1.1.43 H3-K4-HMTase SETD7 histone H3-lysine 4-specific methyltransferase histone-lysine N-methyltransferase SETD7 KIAA1717SET domain-containing protein 7 KMT7FLJ21193 Lysine N-methyltransferase 7 SET domain containing (lysine methyltransferase) 7 SET7/9Histone H3-K4 methyltransferase SETD7 SET7Set9 SET9; H3-K4-HMTase SETD7; Histone H3-K4 methyltransferase SETD7; histone H3-lysine 4-specific methyltransferase; Histone-lysine N-methyltransferase SETD7; Lysine N-methyltransferase 7; SET domain containing (lysine methyltransferase) 7; SET domain-containing protein 7; SET7/9
Gene Aliases: KIAA1717; KMT7; SET7; SET7/9; SET9; SETD7
UniProt ID: (Human) Q8WTS6
Entrez Gene ID: (Human) 80854
Molecular Function:
kinase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.