Novus Biologicals
Manufacturer Code:NBP179446
Catalog # NBP179446
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human SETD3The immunogen for this antibody is SETD3. Peptide sequence AVSSVMTRQNQIPTEDGSRVTLALIPLWDMCNHTNGLTPEDSFALAVASA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Actin-histidine N-methyltransferase; C14orf154 chromosome 14 open reading frame 154 DKFZp761E1415 EC 2.1.1.43 FLJ23027 MGC87236 SET domain containing 3 SET domain-containing protein 3; hSETD3; SET domain-containing protein 3
Gene Aliases: C14orf154; SETD3
UniProt ID: (Human) Q86TU7
Entrez Gene ID: (Human) 84193
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.