Novus Biologicals
Manufacturer Code:NBP160102
Catalog # NBP160102
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SERINC2(serine incorporator 2) The peptide sequence was selected from the N terminal of SERINC2. Peptide sequence VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FKSG84 PRO0899 serine incorporator 2 TDE2 TDE2L; Serine incorporator 2; tumor differentially expressed protein 2; Tumor differentially expressed protein 2-like
Gene Aliases: FKSG84; PRO0899; SERINC2; TDE2; TDE2L; UNQ263/PRO300
UniProt ID: (Human) Q96SA4
Entrez Gene ID: (Human) 347735
Molecular Function:
transmembrane receptor regulatory/adaptor protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.