Novus Biologicals
Manufacturer Code:NBP181423
Catalog # NBP181423
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TNEPETNCNPSLLSIIGYNTTSTVPKEGQSVQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: KIAA1253TDE2 serine incorporator 1 TDE1LTMS-2 tumor differentially expressed 2 Tumor differentially expressed protein 1-like Tumor differentially expressed protein 2; Serine incorporator 1; Tumor differentially expressed protein 1-like; Tumor differentially expressed protein 2
Gene Aliases: KIAA1253; SERINC1; TDE1L; TDE2; TMS-2; TMS2; UNQ396/PRO732
UniProt ID: (Human) Q9NRX5
Entrez Gene ID: (Human) 57515
Molecular Function:
transmembrane receptor regulatory/adaptor protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.