Novus Biologicals
Manufacturer Code:NBP159203
Catalog # NBP159203
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ATP2A2(ATPase Ca++ transporting cardiac muscle slow twitch 2) The peptide sequence was selected from the C terminal of ATP2A2. Peptide sequence VNLVTDGLPATALGFNPPDLDIMNKPPRNPKEPLISGWLFFRYLAIGCYV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATP2BFLJ20293 ATPase Ca++ dependent slow-twitch cardiac muscle-2 ATPase Ca++ transporting cardiac muscle slow twitch 2 Calcium pump 2 Calcium-transporting ATPase sarcoplasmic reticulum type slow twitch skeletalmuscle isoform cardiac Ca2+ ATPase DAR DD EC 3.6.3 EC 3.6.3.8 Endoplasmic reticulum class 1/2 Ca(2+) ATPase FLJ38063 MGC45367 sarcoplasmic/endoplasmic reticulum calcium ATPase 2 SERCA2DKFZp686P0211 SR Ca(2+)-ATPase 2; ATPase Ca++ transporting cardiac muscle slow twitch 2; ATPase, Ca++ dependent, slow-twitch, cardiac muscle-2; ATPase, Ca++ transporting, cardiac muscle, slow twitch 2; Calcium pump 2; Calcium-transporting ATPase sarcoplasmic reticulum type, slow twitch skeletal muscle isoform; cardiac Ca2+ ATPase; Endoplasmic reticulum class 1/2 Ca(2+) ATPase; Sarcoplasmic/endoplasmic reticulum calcium ATPase 2; SERCA2; SR Ca(2+)-ATPase 2
Gene Aliases: ATP2A2; ATP2B; DAR; DD; SERCA2
UniProt ID: (Human) P16615
Entrez Gene ID: (Human) 488
Molecular Function:
cation transporter
hydrolase
ion channel
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.