Novus Biologicals
Manufacturer Code:NBP19842820UL
Catalog # NBP19842820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Mouse |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is Senp6 - C-terminal region. Peptide sequence LAVVCFPGLEKPKYEPNPHYHENAVMQKTPSAEDSCVSSASEMGACSQNS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2810017C20Rik; EC 3.4.22.- KIAA0797FLJ11887 Sentrin/SUMO-specific protease SENP6 sentrin-specific protease 6 SSP1KIAA0389 SUMO1/sentrin specific peptidase 62810017C20Rik SUMO1/sentrin specific protease 6 SUMO-1-specific protease 1 SUSP1FLJ11355; Sentrin-specific protease 6; Sentrin/SUMO-specific protease SENP6; SUMO-1-specific protease 1; SUMO1/sentrin specific protease 6
Gene Aliases: FKSG6; KIAA0797; SENP6; SSP1; SUSP1
UniProt ID: (Human) Q9GZR1
Entrez Gene ID: (Human) 26054
Molecular Function:
extracellular matrix protein
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.