Novus Biologicals
Manufacturer Code:NBP15904220UL
Catalog # NBP15904220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SELS(selenoprotein S) The peptide sequence was selected from the middle region of SELS. Peptide sequence PDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ADO15 MGC104346 SBBI8 selenoprotein S SelS SEPS1 VCP-interacting membrane protein VIMPMGC2553; Selenoprotein S; SelS; valosin-containing protein-interacting membrane protein; VCP-interacting membrane protein; VCP-interacting membrane selenoprotein
Gene Aliases: AD-015; ADO15; SBBI8; SELENOS; SELS; SEPS1; VIMP
UniProt ID: (Human) Q9BQE4
Entrez Gene ID: (Human) 55829
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.