Novus Biologicals
Manufacturer Code:NBP155263
Catalog # NBP155263
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SELENBP1(selenium binding protein 1) The peptide sequence was selected from the C terminal of SELENBP1 (AAH32997). Peptide sequence KQFYPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 56 kDa selenium-binding protein; 56 kDa selenium-binding protein hSBP hSP56 LPSB SBP SBP56 selenium binding protein 1 selenium-binding protein 1 SP56FLJ13813; epididymis secretory sperm binding protein Li 134P; Methanethiol oxidase; MTO; SBP56; Selenium-binding protein 1
Gene Aliases: HEL-S-134P; hSBP; LPSB; SBP; SBP56; SELENBP1; SP56
UniProt ID: (Human) Q13228
Entrez Gene ID: (Human) 8991
Molecular Function: defense/immunity protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.