Novus Biologicals
Manufacturer Code:NBP15510920UL
Catalog # NBP15510920
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to EXOC3(exocyst complex component 3) The peptide sequence was selected from the middle region of EXOC3. Peptide sequence LERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Exocyst complex component 3; exocyst complex component 3 Exocyst complex component Sec6 Sec 6 homolog SEC6 SEC6L1 SEC6-like 1 SEC6-like 1 (S. cerevisiae) Sec6p; Exocyst complex component Sec6; Sec 6 homolog; SEC6-like 1
Gene Aliases: EXOC3; SEC6; SEC6L1; Sec6p
UniProt ID: (Human) O60645
Entrez Gene ID: (Human) 11336
Molecular Function: membrane traffic protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.