Novus Biologicals
Manufacturer Code:NBP187150
Catalog # NBP187150
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:CTTGCPSLLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSFLPLKTGLLIADYLGILHAMDGFVDQKKKL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 1.1.1.105 EPHD-2 epidermal retinol dehydrogenase 2 FLJ33105 RDH-E2epidermal retinal dehydrogenase 2 RDHE2RDH#2 retinal short chain dehydrogenase reductase Retinal short-chain dehydrogenase reductase 2 retSDR2 short chain dehydrogenase/reductase family 16C member 5 Short-chain dehydrogenase/reductase family 16C member 5; EPHD-2; epidermal retinal dehydrogenase 2; Epidermal retinol dehydrogenase 2; retinal short chain dehydrogenase reductase; Retinal short-chain dehydrogenase reductase 2; retSDR2; Short-chain dehydrogenase/reductase family 16C member 5
Gene Aliases: EPHD-2; RDH#2; RDH-E2; RDHE2; retSDR2; SDR16C5
UniProt ID: (Human) Q8N3Y7
Entrez Gene ID: (Human) 195814
Molecular Function: dehydrogenase oxidoreductase reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.