Novus Biologicals
Manufacturer Code:NBP182509
Catalog # NBP182509
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:EEEVKKLKPKGTKNFSLLSFGEEAEEEEEEVNRVSQSMKGKSKSSHDLLKDDPHLSSVPVVESEKGDAPDLVDDGEDESA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Antigen NY-CO-10; Antigen NY-CO-10 CWC27 spliceosome-associated protein homolog (S. cerevisiae) EC 5.2.1.8 NY-CO-10 peptidyl-prolyl cis-trans isomerase SDCCAG10 PPIase CWC27 PPIase SDCCAG10 SDCCAG10 Serologically defined colon cancer antigen 10peptidyl-prolyl cis-trans isomerase CWC27 homolog; CWC27 spliceosome-associated protein homolog; peptidyl-prolyl cis-trans isomerase SDCCAG10; PPIase CWC27; PPIase SDCCAG10; Probable inactive peptidyl-prolyl cis-trans isomerase CWC27 homolog; Serologically defined colon cancer antigen 10; Spliceosome-associated protein CWC27 homolog
Gene Aliases: CWC27; NY-CO-10; SDCCAG-10; SDCCAG10; UNQ438/PRO871
UniProt ID: (Human) Q6UX04
Entrez Gene ID: (Human) 10283
Molecular Function:
isomerase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.