Novus Biologicals
Manufacturer Code:NBP256907
Catalog # NBP256907
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RALLYSLSQPLASLGSGFFGEPDAFPMFTTNNRVKRRPSPYEMEITDGPHTKVVRRI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: bHLHa17; BHLHA17 bHLHa17tal-1 Class A basic helix-loop-helix protein 17 SCLT-cell acute lymphocytic leukemia protein 1 Stem cell protein TAL-1 T-cell acute lymphocytic leukemia 1 T-cell leukemia/lymphoma protein 5 TCL5tal-1 product; Class A basic helix-loop-helix protein 17; Stem cell protein; T-cell acute lymphocytic leukemia 1; T-cell acute lymphocytic leukemia protein 1; T-cell leukemia/lymphoma protein 5; TAL-1; tal-1 product
Gene Aliases: BHLHA17; SCL; tal-1; TAL1; TCL5
UniProt ID: (Human) P17542
Entrez Gene ID: (Human) 6886
Molecular Function:
basic helix-loop-helix transcription factor
nucleic acid binding
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.