Novus Biologicals
Manufacturer Code:NBP160126
Catalog # NBP160126
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SCCPDH(saccharopine dehydrogenase (putative)) The peptide sequence was selected from the C terminal of SCCPDH. Peptide sequence FSFGYFSKQGPTQKQIDAASFTLTFFGQGYSQGTGTDKNKPNIKICTQVK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CGI-49 EC 1.5.1.9 FLJ43187 NET11 probable saccharopine dehydrogenase RP11-439E19.2 saccharopine dehydrogenase (putative); probable saccharopine dehydrogenase; Saccharopine dehydrogenase-like oxidoreductase
Gene Aliases: CGI-49; NET11; SCCPDH
UniProt ID: (Human) Q8NBX0
Entrez Gene ID: (Human) 51097
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.