Novus Biologicals
Manufacturer Code:NBP183572
Catalog # NBP183572
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:PDDLKALTRNVNRLNESFRDLQLRLLQAPLQADLTEQVWKVQDALQNQSDSLLALAGAVQRLE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ23907 MGC45780 scavenger receptor class A member 5 (putative) testis expressed scavenger receptor UNQ2938/PRO28700; Scavenger receptor class A member 5; scavenger receptor class A, member 5 (putative); Scavenger receptor hlg; testis expressed scavenger receptor
Gene Aliases: NET33; SCARA5; Tesr; UNQ2938/PRO28700
UniProt ID: (Human) Q6ZMJ2
Entrez Gene ID: (Human) 286133
Molecular Function:
hydrolase
oxidase
oxidoreductase
protease
receptor
serine protease
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.