Novus Biologicals
Manufacturer Code:NBP17926520UL
Catalog # NBP17926520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the n terminal of human ZNF452. Peptide sequence SRQRFRQFCYQETPGPREALSQLRELCRQWLNPEIHTKEQILELLVLEQF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: dJ1186N24.3 (novel zinc finger protein); dJ1186N24.3 dJ1186N24.3 (novel zinc finger protein) SCAN domain containing 3 ZNF305P2 ZNF452; SCAN domain containing 3; SCAN domain-containing protein 3; Transposon-derived Buster4 transposase-like protein; Zinc finger BED domain-containing protein 9; zinc finger protein 305 pseudogene 2; zinc finger protein 452; zinc finger, BED-type containing 9
Gene Aliases: Buster4; dJ1186N24.3; KIAA1925; SCAND3; ZBED9; ZFP38-L; ZNF305P2; ZNF452
UniProt ID: (Human) Q8TCN2
Entrez Gene ID: (Human) 114821
Molecular Function:
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.