Novus Biologicals
Manufacturer Code:NBP160053
Catalog # NBP160053
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SC5DL(sterol-C5-desaturase (ERG3 delta-5-desaturase homolog S. cerevisiae)-like) The peptide sequence was selected from the N terminal of SC5DL. Peptide sequence NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3beta-hydroxysteroid-delta5-desaturase; 3beta-hydroxysteroid-delta5-desaturase C-5 sterol desaturase Delta(7)-sterol 5-desaturase EC 1.14.21.6 ERG3 fungal ERG3 delta-5-desaturase-like Lathosterol 5-desaturase lathosterol dehydrogenase lathosterol oxidase S5DES SC5D Sterol-C5-desaturase sterol-C5-desaturase (ERG3 delta-5-desaturase homolog fungal)-like sterol-C5-desaturase (ERG3 delta-5-desaturase homolog S. cerevisiae)-like sterol-C5-desaturase (fungal ERG3 delta-5-desaturase)-like; C-5 sterol desaturase; Delta(7)-sterol 5-desaturase; Delta(7)-sterol C5(6)-desaturase; fungal ERG3, delta-5-desaturase-like; Lathosterol 5-desaturase; lathosterol dehydrogenase; Lathosterol oxidase; Sterol-C5-desaturase; sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, S. cerevisiae)-like
Gene Aliases: ERG3; S5DES; SC5D; SC5DL
UniProt ID: (Human) O75845
Entrez Gene ID: (Human) 6309
Molecular Function:
oxidase
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.