Novus Biologicals
Manufacturer Code:NBP237947
Catalog # NBP237947
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DC21 diamine acetyltransferase 1 diamine N-acetyltransferase 1 EC 2.3.1.57 KFSD Polyamine N-acetyltransferase 1 Putrescine acetyltransferase SAT Spermidine/spermine N(1)-acetyltransferase 1 spermidine/spermine N1-acetyltransferase spermidine/spermine N1-acetyltransferase 1 spermidine/spermine N1-acetyltransferase alpha SSAT-1 SSATKFSDX; Diamine acetyltransferase 1; diamine N-acetyltransferase 1; Polyamine N-acetyltransferase 1; Putrescine acetyltransferase; Spermidine/spermine N(1)-acetyltransferase 1; spermidine/spermine N1-acetyltransferase alpha; SSAT
Gene Aliases: DC21; KFSD; KFSDX; SAT; SAT1; SSAT; SSAT-1
UniProt ID: (Human) P21673
Entrez Gene ID: (Human) 6303
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.