Novus Biologicals
Manufacturer Code:NBP15688720UL
Catalog # NBP15688720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CXORF9 The peptide sequence was selected from the N terminal of CXORF9. Peptide sequence KPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGKKLGKKWRAVISRTM. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CXorf9 HACS2 SAM and SH3 domain containing 3 SAM and SH3 domain-containing protein 3 SH3 protein expressed in lymphocytes homolog SH3D6C SLYchromosome X open reading frame 9753P9; SAM and SH3 domain-containing protein 3; SH3 protein expressed in lymphocytes homolog
Gene Aliases: 753P9; CXorf9; HACS2; SASH3; SH3D6C; SLY
UniProt ID: (Human) O75995
Entrez Gene ID: (Human) 54440
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.