Novus Biologicals
Manufacturer Code:NBP233666
Catalog # NBP233666
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QIYNIDPARFKDLNLAGTAEVGLAGYFMDHTVAFRDLPVRMVCSSTCYRAETNTGQEPRGLYRVHHFTKVEMFGVTGPGL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 6.1.1.11 FLJ20450 mitochondrial seryl-tRNA synthetase mtSerRS SARS serine tRNA ligase 2 mitochondrial Serine--tRNA ligase serine-tRNA ligase mitochondrial SerRS SerRSmtSARSM SERS seryl-tRNA synthetase 2 seryl-tRNA synthetase 2 mitochondrial seryl-tRNA synthetase mitochondrial Seryl-tRNA(Ser/Sec) synthetase SYS; mitochondrial seryl-tRNA synthetase; serine tRNA ligase 2, mitochondrial; Serine--tRNA ligase, mitochondrial; serine-tRNA ligase, mitochondrial; SerRS; SerRSmt; Seryl-tRNA synthetase; seryl-tRNA synthetase, mitochondrial; Seryl-tRNA(Ser/Sec) synthetase
Gene Aliases: mtSerRS; SARS; SARS2; SARSM; SerRS; SerRSmt; SERS; SYS
UniProt ID: (Human) Q9NP81
Entrez Gene ID: (Human) 54938
Molecular Function:
RNA binding protein
aminoacyl-tRNA synthetase
ligase
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.