Novus Biologicals
Manufacturer Code:NBP16011320UL
Catalog # NBP1601320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SAMD8(sterile alpha motif domain containing 8) The peptide sequence was selected from the middle region of SAMD8 (NP_653261). Peptide sequence MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Ceramide phosphoethanolamine synthase; CPE synthase; epididymis luminal protein 177; epididymis secretory sperm binding protein Li 181mP; FLJ25082 SAM domain-containing protein 8 SMSr sphingomyelin synthase related sphingomyelin synthase-related protein 1 sterile alpha motif domain containing 8 Sterile alpha motif domain-containing protein 8; HEL-S-181mP; SAM domain-containing protein 8; SMSr; sphingomyelin synthase related; Sphingomyelin synthase-related protein 1; Sterile alpha motif domain-containing protein 8
Gene Aliases: HEL-177; SAMD8; SMSr
UniProt ID: (Human) Q96LT4
Entrez Gene ID: (Human) 142891
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.