Novus Biologicals
Manufacturer Code:NBP247293
Catalog # NBP247293
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEAPRTVKKQIQFADQKQEFNKRPTKI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Adenosylhomocysteinase 3; adenosylhomocysteinase-like 2; adenosylhomocysteinase-like 2 AdoHcyase 3 ADOHCYASE3 EC 3.3.1.1 FLJ21719 KIAA0828S-adenosylhomocysteine hydrolase-like 2 putative adenosylhomocysteinase 3 S-adenosylhomocysteine hydrolase-like protein 2 S-adenosyl-L-homocysteine hydrolase 3; AdoHcyase 3; IP(3)Rs binding protein released with IP(3) 2; IRBIT2; Long-IRBIT; putative adenosylhomocysteinase 3; S-adenosyl-L-homocysteine hydrolase 3; S-adenosylhomocysteine hydrolase-like 2; S-adenosylhomocysteine hydrolase-like protein 2
Gene Aliases: ADOHCYASE3; AHCYL2; IRBIT2; KIAA0828
UniProt ID: (Human) Q96HN2
Entrez Gene ID: (Human) 23382
Molecular Function: hydrolase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.