Novus Biologicals
Manufacturer Code:NBP157062
Catalog # NBP157062
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SAAL1 (serum amyloid A-like 1) The peptide sequence was selected from the N terminal of SAAL1. Peptide sequence MDRNPSPPPPGRDKEEEEEVAGGDCIGSTVYSKHWLFGVLSGLIQIVSPE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ41463 protein SAAL1 serum amyloid A-like 1; Protein SAAL1; serum amyloid A-like 1; SPACIA1; synoviocyte proliferation-associated in collagen-induced arthritis 1; Synoviocyte proliferation-associated in collagen-induced arthritis protein 1
Gene Aliases: SAAL1; SPACIA1
UniProt ID: (Human) Q96ER3
Entrez Gene ID: (Human) 113174
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.