Novus Biologicals
Manufacturer Code:NBP159696
Catalog # NBP159696
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to EDG8(endothelial differentiation sphingolipid G-protein-coupled receptor 8) The peptide sequence was selected from the N terminal of EDG8. Peptide sequence MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Edg-8 EDG8S1P receptor Edg-8 Endothelial differentiation G-protein-coupled receptor 8 endothelial differentiation sphingolipid G-protein-coupled receptor 8 S1P receptor 5 S1P5 sphingosine 1-phosphate receptor 5 sphingosine 1-phosphate receptor EDG8 Sphingosine 1-phosphate receptor Edg-8 sphingosine-1-phosphate receptor 5 SPPR-1 SPPR-2; Endothelial differentiation G-protein-coupled receptor 8; endothelial differentiation, sphingolipid G-protein-coupled receptor, 8; S1P receptor 5; S1P receptor Edg-8; Sphingosine 1-phosphate receptor 5; Sphingosine 1-phosphate receptor Edg-8; sphingosine 1-phosphate receptor EDG8
Gene Aliases: Edg-8; EDG8; S1P5; S1PR5; SPPR-1; SPPR-2
UniProt ID: (Human) Q9H228
Entrez Gene ID: (Human) 53637
Molecular Function:
G-protein coupled receptor
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.