Novus Biologicals
Manufacturer Code:NBP190314
Catalog # NBP190314
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKM |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 60B8AG CAGACP-10 calgranulin A calgranulin-A Calprotectin L1L subunit CFAGL1Ag CGLA Cystic fibrosis antigen Leukocyte L1 complex light chain MA387 MIF Migration inhibitory factor-related protein 8 MRP-8 MRP8S100 calcium binding protein A8 (calgranulin A) NIF P8 protein S100-A8 S100 calcium binding protein A8 S100 calcium-binding protein A8 S100 calcium-binding protein A8 (calgranulin A) Urinary stone protein band A; calgranulin A; Calgranulin-A; Calprotectin L1L subunit; CFAG; Cystic fibrosis antigen; Leukocyte L1 complex light chain; Migration inhibitory factor-related protein 8; MRP-8; Protein S100-A8; S100 calcium-binding protein A8; S100 calcium-binding protein A8 (calgranulin A); Urinary stone protein band A
Gene Aliases: 60B8AG; CAGA; CFAG; CGLA; CP-10; L1Ag; MA387; MIF; MRP8; NIF; P8; S100A8
UniProt ID: (Human) P05109
Entrez Gene ID: (Human) 6279
Molecular Function:
calcium-binding protein
calmodulin
intracellular calcium-sensing protein
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.