Novus Biologicals
Manufacturer Code:NBP238552
Catalog # NBP238552
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Gastrointestinal secretory protein; Gastrointestinal secretory protein GISPREG-4 Reg IV regenerating gene type IV regenerating islet-derived family member 4 regenerating islet-derived protein 4 Regenerating islet-derived protein IV REG-IV RELPREG-like protein; Reg IV; REG-4; REG-like protein; regenerating gene type IV; regenerating islet-derived family, member 4; Regenerating islet-derived protein 4; Regenerating islet-derived protein IV
Gene Aliases: GISP; REG-IV; REG4; RELP
UniProt ID: (Human) Q9BYZ8
Entrez Gene ID: (Human) 83998
Molecular Function:
growth factor
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.