Novus Biologicals
Manufacturer Code:NBP185537
Catalog # NBP185537
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVQALLGVAKCWVARKALDKALDAIE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 43 kDa postsynaptic protein; 43 kDa postsynaptic protein Acetylcholine receptor-associated 43 kDa protein CMS1D43 kDa receptor-associated protein of the synapse CMS1EMGC3597 RAPsyn receptor-associated protein of the synapse receptor-associated protein of the synapse 43kD RNF205RING finger protein 205; 43 kDa receptor-associated protein of the synapse; Acetylcholine receptor-associated 43 kDa protein; RAPsyn; receptor-associated protein of the synapse; RING finger protein 205
Gene Aliases: CMS11; CMS4C; FADS; RAPSN; RAPSYN; RNF205
UniProt ID: (Human) Q13702
Entrez Gene ID: (Human) 5913
Molecular Function: G-protein modulator enzyme modulator guanyl-nucleotide exchange factor transmembrane receptor regulatory/adaptor protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.