Novus Biologicals
Manufacturer Code:NBP255046
Catalog # NBP255046
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SIPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTWSHSVNTRLILQYLDSERRQI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DNA repair protein RAD51 homolog 2; DNA repair protein RAD51 homolog 2 MGC34245 R51H2REC2hREC2 RAD51 (S. cerevisiae)-like 1 RAD51 homolog B RAD51B RAD51-like 1 (S. cerevisiae) RAD51-like protein 1 RecA-like protein recombination repair protein; R51H2; RAD51 homolog B; RAD51-like protein 1; Rad51B; RecA-like protein; recombination repair protein
Gene Aliases: R51H2; RAD51B; RAD51L1; REC2
UniProt ID: (Human) O15315
Entrez Gene ID: (Human) 5890
Molecular Function:
DNA binding protein
DNA strand-pairing protein
hydrolase
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.