Novus Biologicals
Manufacturer Code:NBP192310
Catalog # NBP192310
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:DSPAPNPFSEEDEHPQQRLSSPLVPGNPFEEPTCINPFEIDSDSGPEAEEPIEEELLLQQIDNIKAYIFDAKQC |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 110 kDa protein; 110 kDa protein FLJ34993 FYVE finger-containing Rab5 effector protein rabenosyn-5 FYVE-finger-containing Rab5 effector protein rabenosyn-5 MGC126210 Rabenosyn-5 Zinc finger FYVE domain-containing protein 20 zinc finger FYVE domain containing 20; FYVE finger-containing Rab5 effector protein rabenosyn-5; RAB effector RBSN; Rabenosyn-5; Zinc finger FYVE domain-containing protein 20; zinc finger, FYVE domain containing 20
Gene Aliases: Rabenosyn-5; RBSN; ZFYVE20
UniProt ID: (Human) Q9H1K0
Entrez Gene ID: (Human) 64145
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.