Novus Biologicals
Manufacturer Code:NBP155113
Catalog # NBP155113
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to RAB1A(RAB1A member RAS oncogene family) The peptide sequence was selected from the middle region of RAB1A. Peptide sequence AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp564B163 member RAS oncogene family RAB1A member RAS oncogene family ras-related protein Rab-1A; GTP binding protein Rab1a; Rab GTPase YPT1 homolog; RAB1, member RAS oncogene family; Ras-related protein Rab-1A; YPT1-related protein
Gene Aliases: RAB1; RAB1A; YPT1
UniProt ID: (Human) P62820
Entrez Gene ID: (Human) 5861
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.