Novus Biologicals
Manufacturer Code:NBP238863
Catalog # NBP238863
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Acute myeloid leukemia 2 protein; Acute myeloid leukemia 2 protein AML2SL3/AKV core-binding factor alpha C subunit CBFA3MGC16070 CBF-alpha-3 PEA2 alpha C PEA2-alpha C PEBP2 alpha C PEBP2A3FLJ34510 PEBP2-alpha C runt domain alpha subunit 3 runt-related transcription factor 3 SL3-3 enhancer factor 1 alpha C subunit transcription factor AML2; acute myeloid leukemia gene 2; CBF-alpha-3; Core-binding factor subunit alpha-3; core-binding factor, runt domain, alpha subunit 3; Oncogene AML-2; PEA2 alpha C; PEA2-alpha C; PEBP2 alpha C; PEBP2-alpha C; Polyomavirus enhancer-binding protein 2 alpha C subunit; Runt-related transcription factor 3; SL3-3 enhancer factor 1 alpha C subunit; SL3/AKV core-binding factor alpha C subunit; transcription factor AML2
Gene Aliases: AML2; CBFA3; PEBP2A3; PEBP2aC; RUNX3
UniProt ID: (Human) Q13761
Entrez Gene ID: (Human) 864
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.