Novus Biologicals
Manufacturer Code:NBP256487
Catalog # NBP256487
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Retinoschisin; retinoschisin 1 retinoschisis (X-linked juvenile) 1 RS XL X-linked juvenile retinoschisis protein XLRS1retinoschisin; X-linked juvenile retinoschisis protein
Gene Aliases: RS; RS1; XLRS1
UniProt ID: (Human) O15537
Entrez Gene ID: (Human) 6247
Molecular Function:
cell adhesion molecule
hydrolase
membrane-bound signaling molecule
metalloprotease
protease
receptor
serine protease
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.