Novus Biologicals
Manufacturer Code:NBP230725
Catalog # NBP230725
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKVPRGSGKKRKFQPLFGDFAAEKKNQLELLRVMNSKKP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FSDR2 homolog of yeast ribosome biogenesis regulator homolog of yeast ribosome biogenesis regulatory protein RRS1 KIAA0112ribosome biogenesis regulatory protein RRS1 homolog ribosome biogenesis regulatory protein homolog RRR RRS1 ribosome biogenesis regulator homolog (S. cerevisiae); homolog of yeast ribosome biogenesis regulator; homolog of yeast ribosome biogenesis regulatory protein RRS1; Ribosome biogenesis regulatory protein homolog; ribosome biogenesis regulatory protein RRS1 homolog; RRS1 ribosome biogenesis regulator homolog
Gene Aliases: KIAA0112; RRR; RRS1
UniProt ID: (Human) Q15050
Entrez Gene ID: (Human) 23212
Molecular Function:
RNA binding protein
nucleic acid binding
ribosomal protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.