Novus Biologicals
Manufacturer Code:NBP157217
Catalog # NBP157217
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to RRP9 (RRP9 small subunit (SSU) processome component homolog (yeast)) The peptide sequence was selected from the middle region of RRP9. Peptide sequence IPRAKKGAEGKPPGHSSHVLCMAISSDGKYLASGDRSKLILIWEAQSC |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ribosomal RNA processing 9 small subunit (SSU) processome component homolog(yeast) RNA U3 small nucleolar interacting protein 2 RNU3IP2 RRP9 homolog U3 small nucleolar ribonucleoprotein-associated 55 kDa protein U3 small nucleolar RNA-interacting protein 2 U3 snoRNP-associated 55 kDa protein U3 snoRNP-associated 55-kDa protein U355K U3-55KRRP9 small subunit (SSU) processome component homolog; RNA, U3 small nucleolar interacting protein 2; RRP9 homolog; RRP9, small subunit (SSU) processome component, homolog; U3 small nucleolar ribonucleoprotein-associated 55 kDa protein; U3 small nucleolar RNA-interacting protein 2; U3 snoRNP-associated 55 kDa protein; U3 snoRNP-associated 55-kDa protein
Gene Aliases: RNU3IP2; RRP9; U3-55K; U355K
UniProt ID: (Human) O43818
Entrez Gene ID: (Human) 9136
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.