Novus Biologicals
Manufacturer Code:NBP158189
Catalog # NBP158189
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to RRM2(ribonucleotide reductase M2 polypeptide) The peptide sequence was selected from the N terminal of RRM2. Peptide sequence PALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 1.17.4.1 R2 ribonucleoside-diphosphate reductase subunit M2 ribonucleotide reductase M2 ribonucleotide reductase M2 polypeptide Ribonucleotide reductase small chain Ribonucleotide reductase small subunit RR2 RR2M; Ribonucleoside-diphosphate reductase subunit M2; ribonucleotide reductase M2 polypeptide; Ribonucleotide reductase small chain; Ribonucleotide reductase small subunit
Gene Aliases: R2; RR2; RR2M; RRM2
UniProt ID: (Human) P31350
Entrez Gene ID: (Human) 6241
Molecular Function:
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.