Novus Biologicals
Manufacturer Code:NBP156670
Catalog # NBP156670
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to RRAGC (Ras-related GTP binding C) The peptide sequence was selected from the N terminal of RRAGC)(50ug). Peptide sequence RSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQ. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ13311 GTPase-interacting protein 2 GTR2 Rag C Rag C protein RAGC Ras-related GTP binding C ras-related GTP-binding protein C TIB929; GTPase-interacting protein 2; Rag C; Rag C protein; Ras-related GTP binding C; Ras-related GTP-binding protein C; RRAGC; TIB929
Gene Aliases: GTR2; RAGC; RRAGC; TIB929
UniProt ID: (Human) Q9HB90
Entrez Gene ID: (Human) 64121
Molecular Function:
G-protein
enzyme modulator
small GTPase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.