Novus Biologicals
Manufacturer Code:NBP18047620UL
Catalog # NBP18047620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the C terminal of human RPUSD2. Peptide sequence AEHQAKQSLDVLDLCEGDLSPGLTDSTAPSSELGKDDLEELAAAAQKMEE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C15orf19 C18B11 C18B11 homolog (44.9kD) chromosome 15 open reading frame 19 FLJ31409 RNA pseudouridylate synthase domain containing 2 RNA pseudouridylate synthase domain-containing protein 2; C18B11 homolog (44.9kD); RNA pseudouridylate synthase domain-containing protein 2
Gene Aliases: C15orf19; C18B11; RPUSD2
UniProt ID: (Human) Q8IZ73
Entrez Gene ID: (Human) 27079
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.