Novus Biologicals
Manufacturer Code:NBP159114
Catalog # NBP159114
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to RPSA(ribosomal protein SA) The peptide sequence was selected from the middle region of RPSA (NP_002286). Peptide sequence TFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRY. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 37 kDa laminin receptor; 37 kDa laminin receptor precursor; 37 kDa laminin receptor precursor 37/67 kDa laminin receptor 37LRPNEM/1CHD4 67 kDa laminin receptor 67kD ribosomal protein SA 67LR Colon carcinoma laminin-binding protein LAMBR37 kDa laminin receptor laminin binding protein Laminin receptor 1 laminin receptor 1 (67kD ribosomal protein SA) Laminin-binding protein precursor p40 lamR LAMR 1 LAMR140S ribosomal protein SA LBP LBP/p40 LRP LRP/LR Multidrug resistance-associated protein MGr1-Ag p40 ribosomal protein SA; 37/67 kDa laminin receptor; 37LRP; 40S ribosomal protein SA; 67 kDa laminin receptor; 67LR; Colon carcinoma laminin-binding protein; Laminin receptor 1; laminin receptor 1 (67kD, ribosomal protein SA); Laminin-binding protein precursor p40; LamR; LBP/p40; LRP/LR; Multidrug resistance-associated protein MGr1-Ag; NEM/1CHD4; Small ribosomal subunit protein uS2
Gene Aliases: 37LRP; 67LR; ICAS; LAMBR; lamR; LAMR1; LBP; LBP/p40; LRP; LRP/LR; NEM/1CHD4; p40; RPSA; SA
UniProt ID: (Human) P08865
Entrez Gene ID: (Human) 3921
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.