Novus Biologicals
Manufacturer Code:NBP154792
Catalog # NBP154792
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to RPS21(ribosomal protein S21) The peptide sequence was selected from the N terminal of RPS21. Peptide sequence MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQMNVAEVDKVTGRFNGQF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 40S ribosomal protein S21; 8.2 kDa differentiation factor; human leukemia differentiation factor; ribosomal protein S2140S ribosomal protein S218.2 kDa differentiation factor; Small ribosomal subunit protein eS21
Gene Aliases: HLDF; RPS21; S21
UniProt ID: (Human) P63220
Entrez Gene ID: (Human) 6227
Molecular Function:
RNA binding protein
nucleic acid binding
ribosomal protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.