Novus Biologicals
Manufacturer Code:NBP15547920UL
Catalog # NBP15547920
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to C15ORF15 The peptide sequence was selected from the middle region of C15ORF15. Peptide sequence FIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQED. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 60S ribosomal protein L30 isolog; C15orf15 HRP-L30-iso L30 RLP24 RPL24 RPL24L RSL24D1 ribosomal L24 domain containing 1 TVAS3; homolog of yeast ribosomal like protein 24; my024 protein; Probable ribosome biogenesis protein RLP24; Ribosomal L24 domain-containing protein 1; Ribosomal protein L24-like
Gene Aliases: C15orf15; HRP-L30-iso; L30; My024; RLP24; RPL24; RPL24L; RSL24D1; TVAS3
UniProt ID: (Human) Q9UHA3
Entrez Gene ID: (Human) 51187
Molecular Function:
RNA binding protein
nucleic acid binding
ribosomal protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.