Novus Biologicals
Manufacturer Code:NBP15815620UL
Catalog # NBP15815620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to RPA4(replication protein A4 34kDa) The peptide sequence was selected from the middle region of RPA4. Peptide sequence VPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCD. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: HSU24186 MGC120333 MGC120334 Replication factor A protein 4 replication protein A 30 kDa subunit replication protein A complex 34 kd subunit homolog Rpa4 replication protein A4 30kDa replication protein A4 34kDa RF-A protein 4 RP-A p30; Replication factor A protein 4; Replication protein A 30 kDa subunit; replication protein A complex 34 kd subunit homolog Rpa4; replication protein A4, 30kDa; replication protein A4, 34kDa; RF-A protein 4; RP-A p30
Gene Aliases: HSU24186; RPA4
UniProt ID: (Human) Q13156
Entrez Gene ID: (Human) 29935
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.