Novus Biologicals
Manufacturer Code:NBP213245
Catalog # NBP213245
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: WKYNEFYHVKTSCSQGPAYVCNITNLQPYTSYNVRVVVVYKTGENSTSLP ESFKTKAGVPNKPGIPKLLEGSKNSIQWEKAEDNGC |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: c-ros oncogene 1 , receptor tyrosine kinase; c-Ros receptor tyrosine kinase; Proto-oncogene c-Ros; Proto-oncogene c-Ros-1; Proto-oncogene tyrosine-protein kinase ROS; proto-oncogene tyrosine-protein kinase ROS c-ros oncogene 1 receptor tyrosine kinase c-ros-1 MCF3 ROS; Receptor tyrosine kinase c-ros oncogene 1; ROS proto-oncogene 1 , receptor tyrosine kinase; transmembrane tyrosine-specific protein kinase; v-ros avian UR2 sarcoma virus oncogene homolog 1
Gene Aliases: c-ros-1; MCF3; ROS; ROS1
UniProt ID: (Human) P08922
Entrez Gene ID: (Human) 6098
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.