Novus Biologicals
Manufacturer Code:NBP152828
Catalog # NBP152828
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human RORA (NP_599022). Peptide sequence GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp686M2414 MGC119326 NR1F1MGC119329 nuclear receptor ROR-alpha Nuclear receptor RZR-alpha Nuclear receptor subfamily 1 group F member 1 RAR-related orphan receptor A RAR-related orphan receptor alpha retinoic acid receptor-related orphan receptor alpha retinoid-related orphan receptor alpha Retinoid-related orphan receptor-alpha ROR1 ROR2 ROR3 RZR-ALPHA RZRAROR-alpha transcription factor RZR-alpha; Nuclear receptor ROR-alpha; Nuclear receptor RZR-alpha; Nuclear receptor subfamily 1 group F member 1; RAR-related orphan receptor A; retinoic acid receptor-related orphan receptor alpha; retinoid-related orphan receptor alpha; Retinoid-related orphan receptor-alpha; ROR-alpha; thyroid hormone nuclear receptor alpha variant 4; transcription factor RZR-alpha
Gene Aliases: NR1F1; ROR1; ROR2; ROR3; RORA; RZR-ALPHA; RZRA
UniProt ID: (Human) P35398
Entrez Gene ID: (Human) 6095
Molecular Function:
nuclear hormone receptor
nucleic acid binding
receptor
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.