Novus Biologicals
Manufacturer Code:NBP159546
Catalog # NBP159546
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ROBO2(roundabout axon guidance receptor homolog 2 (Drosophila)) The peptide sequence was selected from the N terminal of ROBO2. Peptide sequence PQPTVRWKKDDADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVGK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Drosophila) homolog 2 roundabout axon guidance receptor homolog 2 (Drosophila); Roundabout homolog 2; roundabout, axon guidance receptor, homolog 2
Gene Aliases: KIAA1568; ROBO2; SAX3
UniProt ID: (Human) Q9HCK4
Entrez Gene ID: (Human) 6092
Molecular Function:
cell adhesion molecule
cytokine receptor
defense/immunity protein
hydrolase
immunoglobulin receptor superfamily
immunoglobulin superfamily cell adhesion molecule
phosphatase
protein phosphatase
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.