Novus Biologicals
Manufacturer Code:NBP188356
Catalog # NBP188356
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:AVSRVVEASDRLQRRVEELCQRVYSRGDSEPLSEAAQAHTRELGRENRRLQDLATQLQEKHHRISLEYSELQDKVTSAETKVLEME |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 95 kDa retinoblastoma protein binding protein; 95 kDa retinoblastoma-associated protein; 95 kDa retinoblastoma-associated protein BRE1-B BRE1BMGC13051 EC 6.3.295 kDa retinoblastoma protein binding protein EC 6.3.2.- KIAA0661BRE1 E3 ubiquitin ligase homolog B Rb-associated protein RBP95E3 ubiquitin-protein ligase BRE1B ring finger protein 40DKFZp686K191 STARING; BRE1 E3 ubiquitin ligase homolog B; BRE1-B; E3 ubiquitin-protein ligase BRE1B; Rb-associated protein; RBP95; RING finger protein 40; ring finger protein 40, E3 ubiquitin protein ligase; RING-type E3 ubiquitin transferase BRE1B
Gene Aliases: BRE1B; KIAA0661; RBP95; RNF40; STARING
UniProt ID: (Human) O75150
Entrez Gene ID: (Human) 9810
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.