Novus Biologicals
Manufacturer Code:NBP256413
Catalog # NBP256413
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunoprecipitation (IP) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NIVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CARP-1; CARP1 Caspase regulator CARP1 Caspases-8 and -10-associated RING finger protein 1 E3 ubiquitin-protein ligase RNF34 EC 6.3.2 EC 6.3.2.- FLJ21786 FYVE-RING finger protein Momo hRFI Human RING finger homologous to inhibitor of apoptosis protein RFI RIF RIFF ring finger protein 34CARP-1 RING finger protein RIFF; Caspase regulator CARP1; Caspases-8 and -10-associated RING finger protein 1; E3 ubiquitin-protein ligase RNF34; FYVE-RING finger protein MOMO; hRFI; Human RING finger homologous to inhibitor of apoptosis protein; RING finger protein 34; ring finger protein 34, E3 ubiquitin protein ligase; RING finger protein RIFF; RING-type E3 ubiquitin transferase RNF34
Gene Aliases: CARP-1; CARP1; hRFI; RFI; RIF; RIFF; RNF34
UniProt ID: (Human) Q969K3
Entrez Gene ID: (Human) 80196
Molecular Function:
ligase
ubiquitin-protein ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.