Novus Biologicals
Manufacturer Code:NBP154794
Catalog # NBP154794
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to RNF207(ring finger protein 207) The peptide sequence was selected from the N terminal of RNF207 (NP_997279). Peptide sequence CLLDCFHDFCAGCLRGRATDGRLTCPLCQHQTVLKGPSGLPPVDRLLQFL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C1orf188 chromosome 1 open reading frame 188 FLJ32096 FLJ46380 FLJ46593 ring finger protein 207; RING finger protein 207
Gene Aliases: C1orf188; RNF207
UniProt ID: (Human) Q6ZRF8
Entrez Gene ID: (Human) 388591
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.